PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 519aa    MW: 58859.6 Da    PI: 8.1099
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054750.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B333.67.1e-112594097
                    ETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3 40 desgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                    +e+g+sW + l++ +  sgr+ +++GW++F+ ang k gD +vFkl+++ e+++v+++f
  Csa07g054750.1  2 NEEGESWIIDLRHeEYPSGRFNMRRGWRRFCVANGKKPGDKMVFKLVQN-EETPVLQLF 59
                    899********994445556**************************995.555887776 PP

2B363.53.4e-2094184497
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     + ++ ++l ++r++lpkkf+ ++g+ k  ++++ l++e+g+sW++ ++++ +sgr++ t+GW++F+ an+ k gD+++Fkl+++ ++ +v++vf
  Csa07g054750.1  94 ASVTTSNLWRDRMYLPKKFILSNGLFK--KFQMLLMNEEGESWKIDMKHEAYSGRFLTTRGWRSFCVANDKKPGDSFIFKLVQN-QEIPVLRVF 184
                     45677888899************9985..568*************************************************995.444677665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100178.73E-8160No hitNo description
PROSITE profilePS5086313.183162IPR003340B3 DNA binding domain
PfamPF023623.3E-9159IPR003340B3 DNA binding domain
SMARTSM010190.0051162IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.3E-10256IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-9259IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.39E-2086181IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-2087181IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.49391187IPR003340B3 DNA binding domain
CDDcd100173.06E-1891185No hitNo description
SMARTSM010195.5E-2792187IPR003340B3 DNA binding domain
PfamPF023624.9E-1894184IPR003340B3 DNA binding domain
SMARTSM010190.0041268341IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-8274337IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.3E-7276337IPR015300DNA-binding pseudobarrel domain
PfamPF023622.8E-7277335IPR003340B3 DNA binding domain
PROSITE profilePS508636.893277343IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MNEEGESWII DLRHEEYPSG RFNMRRGWRR FCVANGKKPG DKMVFKLVQN EETPVLQLFP  60
IDSEDQEKLE NVPRKKSRKE EEDYSPDDCS CFVASVTTSN LWRDRMYLPK KFILSNGLFK  120
KFQMLLMNEE GESWKIDMKH EAYSGRFLTT RGWRSFCVAN DKKPGDSFIF KLVQNQEIPV  180
LRVFPLYSED RHKLEPSNDT RQGKCLKATK AEFLGIEDYR DASLQGKCFK AGVAEPTGED  240
TRQRKRSQAI KQEYVSVEGN NSTGQNQLVT LTLTPARKIT MLDIYGSRWR TSLLMDNRGT  300
MSLGKGSKGF CEVHGVKMHE SFVLELIWED TVPLLKFALF LNCRCLIRWL VGYYDGFVAH  360
MVLKLIGFFL GTTTRPALIS LLGLPGKLIK SIQDGFEGWT IFTTKFVFLI SFLSFKPTIG  420
EGGIICTLPN SCSQSPTLKS AFSLSSDDIF CYLGTGLGLN ASTTAANLSK EEDQMFASCR  480
FSEDSAGNEL FALLQTLNVM EVLQHVIRNH GNEKSQSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472483.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X2
RefseqXP_010429457.10.0PREDICTED: B3 domain-containing protein REM10-like
SwissprotP0DH851e-154REM10_ARATH; B3 domain-containing protein REM10
TrEMBLR0FW981e-167R0FW98_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_40003921e-160(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144901522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-155B3 family protein